Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP1 Peptide - N-terminal region

ARHGAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDC42GAP, RHOGAP, RHOGAP1, p50rhoGAP

UniProt

Q07960

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGAP1 Rabbit Polyclonal Antibody (orb330774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004299

Preservative

Lyophilized powder

AA Sequence

MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Klhl23 Pre-designed siRNA Set A
SI207314A 1 Each

Rat Klhl23 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Myc tag mouse monoclonal antibody
TD-AB0012 100 µg

Myc tag mouse monoclonal antibody

Sign In for Pricing
View Details
Dog Serum amyloid A protein ELISA Kit
EK2402 Inquire

Dog Serum amyloid A protein ELISA Kit

Sign In for Pricing
View Details
CCDC106 siRNA (h)
sc-97806 10 µM

CCDC106 siRNA (h)

Sign In for Pricing
View Details
CHCHD1 siRNA Oligos set (Human)
16019171 3x 5 nmol

CHCHD1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal HLA DRA Antibody
NBP2-38619-25ul 25 µL

Rabbit Polyclonal HLA DRA Antibody

Sign In for Pricing
View Details