Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP1 Peptide - N-terminal region

ARHGAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDC42GAP, RHOGAP, RHOGAP1, p50rhoGAP

UniProt

Q07960

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGAP1 Rabbit Polyclonal Antibody (orb330774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004299

Preservative

Lyophilized powder

AA Sequence

MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETAR Recombinant Rabbit mAb
orb3184835-01 25 µL

ETAR Recombinant Rabbit mAb

Sign In for Pricing
View Details
ETAR Recombinant Rabbit mAb
orb3184835-02 50 µL

ETAR Recombinant Rabbit mAb

Sign In for Pricing
View Details
ETAR Recombinant Rabbit mAb
orb3184835-03 100 µL

ETAR Recombinant Rabbit mAb

Sign In for Pricing
View Details
Maackia amurensis Lectin (MAA/MAL I+II) - Semi-Pure
21511392-1 50 mg

Maackia amurensis Lectin (MAA/MAL I+II) - Semi-Pure

Sign In for Pricing
View Details
Dibutyl 3,3'-((2-Hydroxyethyl)azanediyl)dipropionate
TRC-D224950-100MG 100 mg

Dibutyl 3,3'-((2-Hydroxyethyl)azanediyl)dipropionate

Sign In for Pricing
View Details
Magic™ Membrane Protein Human DPP4 (Dipeptidyl peptidase 4) Expressed in vitro E.coli expression system, Full Length
MPX4035K Each

Magic™ Membrane Protein Human DPP4 (Dipeptidyl peptidase 4) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details