Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP20 Peptide - middle region

ARHGAP20 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1391, RARHOGAP

UniProt

Q9P2F6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGAP20 Rabbit Polyclonal Antibody (orb583572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065860

Preservative

Lyophilized powder

AA Sequence

YSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF568 conjugate, 0.1mg/mL
BNC682959-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tm6sf1 Mouse Gene Knockout Kit (CRISPR)
KN517644 1 Kit

Tm6sf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LIPF (NM_001198829) Human Over-expression Lysate
LY434213 100 µg

LIPF (NM_001198829) Human Over-expression Lysate

Sign In for Pricing
View Details
ESD Rabbit Polyclonal Antibody
R1511-9 100 µL

ESD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human APRIL (TNFSF13)
6455 5 µg

Recombinant Human APRIL (TNFSF13)

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF647 conjugate, 0.1mg/mL
BNC471812-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details