Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP20 Peptide - middle region

ARHGAP20 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1391, RARHOGAP

UniProt

Q9P2F6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGAP20 Rabbit Polyclonal Antibody (orb583572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065860

Preservative

Lyophilized powder

AA Sequence

YSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP6 (NM_001135211) Human Over-expression Lysate
LC427592 20 µg

FKBP6 (NM_001135211) Human Over-expression Lysate

Sign In for Pricing
View Details
LAMA1 Polyclonal Antibody
E-AB-15755-01 20 µL

LAMA1 Polyclonal Antibody

Sign In for Pricing
View Details
LAMA1 Polyclonal Antibody
E-AB-15755-02 60 µL

LAMA1 Polyclonal Antibody

Sign In for Pricing
View Details
LAMA1 Polyclonal Antibody
E-AB-15755-03 120 µL

LAMA1 Polyclonal Antibody

Sign In for Pricing
View Details
LAMA1 Polyclonal Antibody
E-AB-15755-04 200 µL

LAMA1 Polyclonal Antibody

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3495), CF647 conjugate, 0.1mg/mL
BNC473495-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3495), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details