Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP28 Peptide - C-terminal region

ARHGAP28 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686A2038, FLJ10312

UniProt

Q9P2N2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARHGAP28 Rabbit Polyclonal Antibody (orb582126) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010000

Preservative

Lyophilized powder

AA Sequence

TKAKDILAKFQYENSHGSSECIKIQNQRLYEIGGNIGEHCLDPDAYILDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Electric Wheelchair BHBD-912
BHBD-912 1 Unit

Electric Wheelchair BHBD-912

Sign In for Pricing
View Details
ZAK (MAP3K20) (NM_016653) Human Recombinant Protein
TP321970L 1 mg

ZAK (MAP3K20) (NM_016653) Human Recombinant Protein

Sign In for Pricing
View Details
Calcein AM Assay Buffer
E-CK-A153 100 mL

Calcein AM Assay Buffer

Sign In for Pricing
View Details
Palbociclib-d4 Hydrochloride
TRC-P139937-5MG 5 mg

Palbociclib-d4 Hydrochloride

Sign In for Pricing
View Details
Recombinant GGH Antibody
RC-16577-01 50 μL

Recombinant GGH Antibody

Sign In for Pricing
View Details
Recombinant GGH Antibody
RC-16577-02 100 µL

Recombinant GGH Antibody

Sign In for Pricing
View Details