Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arhgap5 Peptide - N-terminal region

Arhgap5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P190-B

UniProt

E9PYT0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arhgap5 Rabbit Polyclonal Antibody (orb575249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033836

Preservative

Lyophilized powder

AA Sequence

MMAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF395 Rabbit Polyclonal Antibody
AP11827PU-N 400 µL

ZNF395 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
o-Nitrophenyl 2-Acetamido-2-deoxy-Alpha-D-galactopyranoside
TRC-N499250-50MG 50 mg

o-Nitrophenyl 2-Acetamido-2-deoxy-Alpha-D-galactopyranoside

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-14074-01 20 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-14074-02 60 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-14074-03 120 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-14074-04 200 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details