Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arhgap5 Peptide - N-terminal region

Arhgap5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P190-B

UniProt

E9PYT0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arhgap5 Rabbit Polyclonal Antibody (orb575249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033836

Preservative

Lyophilized powder

AA Sequence

MMAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Micro Bead Sterlizer, TALL, with glass beads
B1202-E 1 Each

Micro Bead Sterlizer, TALL, with glass beads

Sign In for Pricing
View Details
Dabigatran Etexilate
TRC-D100140-5G 5 g

Dabigatran Etexilate

Sign In for Pricing
View Details
IL36A Mouse, His
OM296392-01 20 µg

IL36A Mouse, His

Sign In for Pricing
View Details
IL36A Mouse, His
OM296392-02 5 µg

IL36A Mouse, His

Sign In for Pricing
View Details
IL36A Mouse, His
OM296392-03 1 mg

IL36A Mouse, His

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF594 conjugate, 0.1mg/mL
BNC941497-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details