ARHGEF19 Peptide - middle region
ARHGEF19 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ33962, RP4-733M16.1, WGEF
UniProt
Q8IW93
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARHGEF19 Rabbit Polyclonal Antibody (orb581960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_694945
Preservative
Lyophilized powder
AA Sequence
RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
035211-AP 200 µL
ERLIN2, CT (ERLIN2, C8orf2, SPFH2, Erlin-2, Endoplasmic reticulum lipid raft-associated protein 2, Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2) (AP) discontinued
Sign In for Pricing
View Details GTR15324674 1 Vial
Lentiviral human CASP3 shRNA (UAS) - Lentiviral human CASP3 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
NBP1-76788AF488 0.1 mL
Rabbit Polyclonal IKBKAP Antibody [Alexa Fluor 488]
Sign In for Pricing
View Details 