Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARID5B Peptide - C-terminal region

ARID5B Peptide - C-terminal region

Product Specifications

Product Name Alternative

DESRT, FLJ21150, MRF2, MRF-2

UniProt

Q14865

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARID5B Rabbit Polyclonal Antibody (orb581185) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115575

Preservative

Lyophilized powder

AA Sequence

VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Retinoid X Receptor Alpha (RXRa) ELISA Kit
RDR-RXRa-Hu-01 96 Tests

Human Retinoid X Receptor Alpha (RXRa) ELISA Kit

Sign In for Pricing
View Details
Human Retinoid X Receptor Alpha (RXRa) ELISA Kit
RDR-RXRa-Hu-02 48 Tests

Human Retinoid X Receptor Alpha (RXRa) ELISA Kit

Sign In for Pricing
View Details
2-Bromophenanthrene
TRC-B678870-25MG 25 mg

2-Bromophenanthrene

Sign In for Pricing
View Details
Xylazine-KLH Conjugate
50621-AAT 1 mg

Xylazine-KLH Conjugate

Sign In for Pricing
View Details
AGXT2L1 (ETNPPL) (NM_001146627) Human Over-expression Lysate
LC431381 20 µg

AGXT2L1 (ETNPPL) (NM_001146627) Human Over-expression Lysate

Sign In for Pricing
View Details
Lamin A/C Recombinant Rabbit Monoclonal Antibody [JE51-60]
ET7110-12 100 µL

Lamin A/C Recombinant Rabbit Monoclonal Antibody [JE51-60]

Sign In for Pricing
View Details