ARID5B Peptide - C-terminal region
ARID5B Peptide - C-terminal region
Product Specifications
Product Name Alternative
DESRT, FLJ21150, MRF2, MRF-2
UniProt
Q14865
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARID5B Rabbit Polyclonal Antibody (orb581185) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115575
Preservative
Lyophilized powder
AA Sequence
VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSQ050080-01 10 µg
Recombinant Rhesus macaque CD160 Protein (His Tag)
Sign In for Pricing
View Details PKSQ050080-02 50 µg
Recombinant Rhesus macaque CD160 Protein (His Tag)
Sign In for Pricing
View Details 
BNC883308-100 1x 100 µL
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/3308), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
