Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL6IP1 Peptide - C-terminal region

ARL6IP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIP1, ARL6IP, ARMER, KIAA0069

UniProt

Q15041

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL6IP1 Rabbit Polyclonal Antibody (orb585043) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055976

Preservative

Lyophilized powder

AA Sequence

QVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNN2 Polyclonal Antibody
E-AB-18171-01 20 µL

KCNN2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNN2 Polyclonal Antibody
E-AB-18171-02 60 µL

KCNN2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNN2 Polyclonal Antibody
E-AB-18171-03 120 µL

KCNN2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNN2 Polyclonal Antibody
E-AB-18171-04 200 µL

KCNN2 Polyclonal Antibody

Sign In for Pricing
View Details
Succinyl Triticum vulgare (Wheat Germ) -Succinyl WGA Gel- Immobilized Lectin
AK-2102-2 2 mL

Succinyl Triticum vulgare (Wheat Germ) -Succinyl WGA Gel- Immobilized Lectin

Sign In for Pricing
View Details
SINHCAF (NM_001135811) Human Over-expression Lysate
LY427712 100 µg

SINHCAF (NM_001135811) Human Over-expression Lysate

Sign In for Pricing
View Details