Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL8B Peptide - middle region

ARL8B Peptide - middle region

Product Specifications

Product Name Alternative

ARL10C, FLJ10702, Gie1

UniProt

Q9NVJ2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL8B Rabbit Polyclonal Antibody (orb583457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060654

Preservative

Lyophilized powder

AA Sequence

SRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Suppressor of cytokine signaling 3
E1684b 96 Tests

ELISA Kit For Suppressor of cytokine signaling 3

Sign In for Pricing
View Details
Human TSH (Thyroid Stimulating Hormone) ELISA Kit
EKF60486 96 Tests

Human TSH (Thyroid Stimulating Hormone) ELISA Kit

Sign In for Pricing
View Details
ECH1 Polyclonal Antibody, Biotin Conjugated
bs-13048R-Biotin 100 µL

ECH1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
IL1B Antibody
MBS7117445-01 0.05 mg

IL1B Antibody

Sign In for Pricing
View Details
IL1B Antibody
MBS7117445-02 0.1 mg

IL1B Antibody

Sign In for Pricing
View Details
IL1B Antibody
MBS7117445-03 5x 0.1 mg

IL1B Antibody

Sign In for Pricing
View Details