Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL8B Peptide - middle region

ARL8B Peptide - middle region

Product Specifications

Product Name Alternative

ARL10C, FLJ10702, Gie1

UniProt

Q9NVJ2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL8B Rabbit Polyclonal Antibody (orb583457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060654

Preservative

Lyophilized powder

AA Sequence

SRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Angiopoietin 1, ANG-1 ELISA Kit
MBS164061-01 48 Well

Rat Angiopoietin 1, ANG-1 ELISA Kit

Sign In for Pricing
View Details
Rat Angiopoietin 1, ANG-1 ELISA Kit
MBS164061-02 96 Well

Rat Angiopoietin 1, ANG-1 ELISA Kit

Sign In for Pricing
View Details
Rat Angiopoietin 1, ANG-1 ELISA Kit
MBS164061-03 5x 96 Well

Rat Angiopoietin 1, ANG-1 ELISA Kit

Sign In for Pricing
View Details
Rat Angiopoietin 1, ANG-1 ELISA Kit
MBS164061-04 10x 96 Well

Rat Angiopoietin 1, ANG-1 ELISA Kit

Sign In for Pricing
View Details
LZTS1 Antibody
MBS7129243-01 0.05 mL

LZTS1 Antibody

Sign In for Pricing
View Details
LZTS1 Antibody
MBS7129243-02 0.1 mL

LZTS1 Antibody

Sign In for Pricing
View Details