Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC8 Peptide - N-terminal region

ARMC8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSPC056, MGC10058, MGC4880, S863-2

UniProt

Q8IUR7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMC8 Rabbit Polyclonal Antibody (orb582983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_998819

Preservative

Lyophilized powder

AA Sequence

KVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPRT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F2]
TA506872AM 100 µL

UPRT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F2]

Sign In for Pricing
View Details
Recombinant MelanA Antibody
RC-15419-01 50 μL

Recombinant MelanA Antibody

Sign In for Pricing
View Details
Recombinant MelanA Antibody
RC-15419-02 100 µL

Recombinant MelanA Antibody

Sign In for Pricing
View Details
Recombinant MelanA Antibody
RC-15419-03 1 mL

Recombinant MelanA Antibody

Sign In for Pricing
View Details
JUND pSer255 Rabbit Polyclonal Antibody
AP01624PU-N 100 µg

JUND pSer255 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNA-PKcs/PRKDC Mouse Monoclonal Antibody [2-B3]
M1204-6 100 µL

DNA-PKcs/PRKDC Mouse Monoclonal Antibody [2-B3]

Sign In for Pricing
View Details