Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMC8 Peptide - N-terminal region

ARMC8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSPC056, MGC10058, MGC4880, S863-2

UniProt

Q8IUR7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARMC8 Rabbit Polyclonal Antibody (orb582983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_998819

Preservative

Lyophilized powder

AA Sequence

KVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrkA (NTRK1) pTyr791 Rabbit Polyclonal Antibody
AP12733PU-N 400 µL

TrkA (NTRK1) pTyr791 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Hydroxy-6-(2-oxoheptyl)-2H-pyran-2-one
TRC-H949808-10MG 10 mg

4-Hydroxy-6-(2-oxoheptyl)-2H-pyran-2-one

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS715514 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
BORCS6 Antibody
KC-3299-01 50 μL

BORCS6 Antibody

Sign In for Pricing
View Details
BORCS6 Antibody
KC-3299-02 100 µL

BORCS6 Antibody

Sign In for Pricing
View Details
BORCS6 Antibody
KC-3299-03 1 mL

BORCS6 Antibody

Sign In for Pricing
View Details