What is the catalog number for Arnt Peptide - N-terminal region?

The catalog number for Arnt Peptide - N-terminal region is orb2011715.

What sizes are available for Arnt Peptide - N-terminal region?

Arnt Peptide - N-terminal region is available in the following size(s): 100 µg.

Is Arnt Peptide - N-terminal region in stock?

Arnt Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Arnt Peptide - N-terminal region

Product Specifications

Product Name Alternative

D3Ertd557e, Drnt, ESTM42, Hif1b, KIAA4051, W08714, bHLHe2, mKIAA4051

UniProt

Q3ULM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_033839

Preservative

Lyophilized powder

AA Sequence

DEVEVNTKFLRCDDDQMCNDKERFARENHSEIERRRRNKMTAYITELSDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10756084 1.0 µg

4933416I08Rik 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing

View Details

MBS8585401-01 0.1 mg

Chk2 (Phospho-Thr68) Polyclonal Antibody

Sign In for Pricing

View Details

MBS8585401-02 0.1 mL (AF405L)

Chk2 (Phospho-Thr68) Polyclonal Antibody

Sign In for Pricing

View Details

MBS8585401-03 0.1 mL (AF405S)

Chk2 (Phospho-Thr68) Polyclonal Antibody

Sign In for Pricing

View Details

MBS8585401-04 0.1 mL (AF610)

Chk2 (Phospho-Thr68) Polyclonal Antibody

Sign In for Pricing

View Details

MBS8585401-05 0.1 mL (AF635)

Chk2 (Phospho-Thr68) Polyclonal Antibody

Sign In for Pricing

View Details