Arnt Peptide - N-terminal region
Arnt Peptide - N-terminal region
Product Specifications
Product Name Alternative
D3Ertd557e, Drnt, ESTM42, Hif1b, KIAA4051, W08714, bHLHe2, mKIAA4051
UniProt
Q3ULM2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_033839
Preservative
Lyophilized powder
AA Sequence
DEVEVNTKFLRCDDDQMCNDKERFARENHSEIERRRRNKMTAYITELSDM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2510243-01 24 Tests
Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit
Sign In for Pricing
View Details MBS2510243-02 48 Tests
Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit
Sign In for Pricing
View Details MBS2510243-03 96 Tests
Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit
Sign In for Pricing
View Details MBS2510243-04 5x 96 Tests
Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit
Sign In for Pricing
View Details MBS2510243-05 10x 96 Tests
Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit
Sign In for Pricing
View Details