Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arnt Peptide - N-terminal region

Arnt Peptide - N-terminal region

Product Specifications

Product Name Alternative

D3Ertd557e, Drnt, ESTM42, Hif1b, KIAA4051, W08714, bHLHe2, mKIAA4051

UniProt

Q3ULM2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_033839

Preservative

Lyophilized powder

AA Sequence

DEVEVNTKFLRCDDDQMCNDKERFARENHSEIERRRRNKMTAYITELSDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

genesig Std Real-time PCR detection kit for A.vasorum
Z-Path-A-vasorum-std 150 Tests

genesig Std Real-time PCR detection kit for A.vasorum

Sign In for Pricing
View Details
Anti-ACOT11 antibody
PAab00089 100 µg

Anti-ACOT11 antibody

Sign In for Pricing
View Details
TOMM7 AAV siRNA Pooled Vector
47298161 1.0 µg

TOMM7 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ADP/ATP Ratio Assay Kit (Bioluminescent)
TBS2015 100 Tests

ADP/ATP Ratio Assay Kit (Bioluminescent)

Sign In for Pricing
View Details
Sodium tetrachloropalladate (II) ; 99.95% (metals basis)
GX1318-1g 1 g

Sodium tetrachloropalladate (II) ; 99.95% (metals basis)

Sign In for Pricing
View Details
ASPDH (NM_001114598) Human Recombinant Protein
E45H33593M5 20 µg

ASPDH (NM_001114598) Human Recombinant Protein

Sign In for Pricing
View Details