Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arntl2 Peptide - C-terminal region

Arntl2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4632430A05Rik, BMAL2, CLIF, MGC124257, MOP9, bHLHe6

UniProt

Q2VPD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arntl2 Rabbit Polyclonal Antibody (orb574444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758513

Preservative

Lyophilized powder

AA Sequence

AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF2 Recombinant Monoclonal Antibody [3D12]
A73776-050 50 µL

ATF2 Recombinant Monoclonal Antibody [3D12]

Sign In for Pricing
View Details
Bid Rabbit pAb, PE-Cy7 conjugated
orb2823708 100 µL

Bid Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis xerC Protein (aa 1-298)
VAng-Yyj3668-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Bovis xerC Protein (aa 1-298)

Sign In for Pricing
View Details
SAMD8 siRNA (Human)
MBS8207406-01 15 nmol

SAMD8 siRNA (Human)

Sign In for Pricing
View Details
SAMD8 siRNA (Human)
MBS8207406-02 30 nmol

SAMD8 siRNA (Human)

Sign In for Pricing
View Details
SAMD8 siRNA (Human)
MBS8207406-03 5x 30 nmol

SAMD8 siRNA (Human)

Sign In for Pricing
View Details