Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arntl2 Peptide - C-terminal region

Arntl2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4632430A05Rik, BMAL2, CLIF, MGC124257, MOP9, bHLHe6

UniProt

Q2VPD4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arntl2 Rabbit Polyclonal Antibody (orb574444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758513

Preservative

Lyophilized powder

AA Sequence

AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VGLL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
49497066 1.0 µg DNA

VGLL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
anti-Cyclin D2
YF-PA10729 100 ug

anti-Cyclin D2

Sign In for Pricing
View Details
Mouse BLC Penis cDNA
MD-416-BLC 30 Reactions

Mouse BLC Penis cDNA

Sign In for Pricing
View Details
Phosphorothioate (SOX) 25 nmol scale
26-6401-25 1 Each

Phosphorothioate (SOX) 25 nmol scale

Sign In for Pricing
View Details
PIGP Rabbit Polyclonal Antibody (HRP)
orb2091611 100 µL

PIGP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
H3R antagonist 7
orb3136916-01 10 mg

H3R antagonist 7

Sign In for Pricing
View Details