ARPC3 Peptide - middle region
ARPC3 Peptide - middle region
Product Specifications
Product Name Alternative
ARC21, p21-Arc
UniProt
O15145
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARPC3 Rabbit Polyclonal Antibody (orb330660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005710
Preservative
Lyophilized powder
AA Sequence
ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
More Discoveries
Explore Other Products
Browse additional items from our catalog
252696-ML490 100 µL
TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 490)
Sign In for Pricing
View Details RC208647L4 10 µg
FAM113A (PCED1A) (NM_022760) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 18289111 3x 1.0 µg
DLK2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
K3829302 1.0 µg DNA
Gnai1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 