Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPC3 Peptide - middle region

ARPC3 Peptide - middle region

Product Specifications

Product Name Alternative

ARC21, p21-Arc

UniProt

O15145

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARPC3 Rabbit Polyclonal Antibody (orb330660) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005710

Preservative

Lyophilized powder

AA Sequence

ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 3 (CASP3) Human shRNA Plasmid Kit (Locus ID 836)
TR305638 1 Kit

Caspase 3 (CASP3) Human shRNA Plasmid Kit (Locus ID 836)

Sign In for Pricing
View Details
hsa-miR-4665-5p miRNA Antagomir
MBS8317415-01 10 nmol

hsa-miR-4665-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-4665-5p miRNA Antagomir
MBS8317415-02 20 nmol

hsa-miR-4665-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-4665-5p miRNA Antagomir
MBS8317415-03 5x 20 nmol

hsa-miR-4665-5p miRNA Antagomir

Sign In for Pricing
View Details
Rabbit Anti-Human RELA pAb
PA9960-01 50 μL

Rabbit Anti-Human RELA pAb

Sign In for Pricing
View Details
Rabbit Anti-Human RELA pAb
PA9960-02 100 μL

Rabbit Anti-Human RELA pAb

Sign In for Pricing
View Details