Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPM1 Peptide - N-terminal region

ARPM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC15664, ARPM1

UniProt

Q9BYD9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARPM1 Rabbit Polyclonal Antibody (orb584614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115876

Preservative

Lyophilized powder

AA Sequence

NIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10-Oxo oxymorphone discontinued
286122-01 1 mg

10-Oxo oxymorphone discontinued

Sign In for Pricing
View Details
10-Oxo oxymorphone discontinued
286122-02 2 mg

10-Oxo oxymorphone discontinued

Sign In for Pricing
View Details
10-Oxo oxymorphone discontinued
286122-03 5 mg

10-Oxo oxymorphone discontinued

Sign In for Pricing
View Details
10-Oxo oxymorphone discontinued
286122-04 10 mg

10-Oxo oxymorphone discontinued

Sign In for Pricing
View Details
Research Grade Anti-Human APP/Amyloid beta (CNTO 2125)
DHC12520 100 μg

Research Grade Anti-Human APP/Amyloid beta (CNTO 2125)

Sign In for Pricing
View Details
Twist2 Antibody
MBS9613094-01 0.05 mL

Twist2 Antibody

Sign In for Pricing
View Details