Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPM1 Peptide - N-terminal region

ARPM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC15664, ARPM1

UniProt

Q9BYD9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARPM1 Rabbit Polyclonal Antibody (orb584614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115876

Preservative

Lyophilized powder

AA Sequence

NIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lefamulin
E4877-1g 1 g

Lefamulin

Sign In for Pricing
View Details
Lentiviral human UTP11 sgRNA gene knockout kit - Lentiviral human UTP11 sgRNA gene knockout kit (100)
GTR15362707 1 Vial

Lentiviral human UTP11 sgRNA gene knockout kit - Lentiviral human UTP11 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Bovine Parathyroid hormone receptor ELISA Kit
MBS7233281-01 48 Well

Bovine Parathyroid hormone receptor ELISA Kit

Sign In for Pricing
View Details
Bovine Parathyroid hormone receptor ELISA Kit
MBS7233281-02 96 Well

Bovine Parathyroid hormone receptor ELISA Kit

Sign In for Pricing
View Details
Bovine Parathyroid hormone receptor ELISA Kit
MBS7233281-03 5x 96 Well

Bovine Parathyroid hormone receptor ELISA Kit

Sign In for Pricing
View Details
Bovine Parathyroid hormone receptor ELISA Kit
MBS7233281-04 10x 96 Well

Bovine Parathyroid hormone receptor ELISA Kit

Sign In for Pricing
View Details