Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARRB1 Peptide - middle region

ARRB1 Peptide - middle region

Product Specifications

Product Name Alternative

ARB1, ARR1

UniProt

P49407

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARRB1 Rabbit Polyclonal Antibody (orb573643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004032

Preservative

Lyophilized powder

AA Sequence

NETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNHG9 sgRNA CRISPR Lentivector set (Human)
K2210901 3x 1.0 µg

SNHG9 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CD96 AAV siRNA Pooled Vector
15582161 1.0 µg

CD96 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
MCT1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61785R-BF555 100 µL

MCT1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Fmoc-Asp (OtBu) -Cys (Psi (Me, Me) pro) -OH
OR36452-01 250 mg

Fmoc-Asp (OtBu) -Cys (Psi (Me, Me) pro) -OH

Sign In for Pricing
View Details
Fmoc-Asp (OtBu) -Cys (Psi (Me, Me) pro) -OH
OR36452-02 1 g

Fmoc-Asp (OtBu) -Cys (Psi (Me, Me) pro) -OH

Sign In for Pricing
View Details
Torsin2A Lentiviral Activation Particles (m)
sc-424416-LAC 200 µL

Torsin2A Lentiviral Activation Particles (m)

Sign In for Pricing
View Details