Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arsb Peptide - middle region

Arsb Peptide - middle region

Product Specifications

Product Name Alternative

1110007C02Rik, AI480648, As-1, As-1r, As-1s, As-1t, As1, As1-r, As1-s, As1-t, Asr-1, Ast-1

UniProt

P50429

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arsb Rabbit Polyclonal Antibody (orb584138) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033842

Preservative

Lyophilized powder

AA Sequence

TDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Specimen of Sea Horse Single
4113600/3A 1 Each

Specimen of Sea Horse Single

Sign In for Pricing
View Details
C-Reactive Protein (CRP, MGC88244, PTX 1, PTX1) (MaxLight 650)
MBS6257753-01 0.1 mL

C-Reactive Protein (CRP, MGC88244, PTX 1, PTX1) (MaxLight 650)

Sign In for Pricing
View Details
C-Reactive Protein (CRP, MGC88244, PTX 1, PTX1) (MaxLight 650)
MBS6257753-02 5x 0.1 mL

C-Reactive Protein (CRP, MGC88244, PTX 1, PTX1) (MaxLight 650)

Sign In for Pricing
View Details
ZNHIT3 Protein Vector (Mouse) (pPM-C-HA)
PV250976 500 ng

ZNHIT3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
RYK Antibody Blocking peptide
orb1446097 500 µg

RYK Antibody Blocking peptide

Sign In for Pricing
View Details
PLX-4720
MBS385966-01 10 mg

PLX-4720

Sign In for Pricing
View Details