Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART1 Peptide - C-terminal region

ART1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ART2, CD296, MGC133217, RT6

UniProt

P52961

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ART1 Rabbit Polyclonal Antibody (orb584605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004305

Preservative

Lyophilized powder

AA Sequence

KHSTYNCEYIKDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biological Microscope BMIC-203
BMIC-203 1 Unit

Biological Microscope BMIC-203

Sign In for Pricing
View Details
2-Vinylthiophene (Stabilized with BHT)
TRC-V756998-50MG 50 mg

2-Vinylthiophene (Stabilized with BHT)

Sign In for Pricing
View Details
Human Angiopoietin-1/ANGPT1, Tag Free
HA210884-01 20 µg

Human Angiopoietin-1/ANGPT1, Tag Free

Sign In for Pricing
View Details
Human Angiopoietin-1/ANGPT1, Tag Free
HA210884-02 50 µg

Human Angiopoietin-1/ANGPT1, Tag Free

Sign In for Pricing
View Details
Human Angiopoietin-1/ANGPT1, Tag Free
HA210884-03 100 µg

Human Angiopoietin-1/ANGPT1, Tag Free

Sign In for Pricing
View Details
4-Acetamidobenzyl Alcohol
TRC-B400633-50MG 50 mg

4-Acetamidobenzyl Alcohol

Sign In for Pricing
View Details