ART1 Peptide - C-terminal region
ART1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ART2, CD296, MGC133217, RT6
UniProt
P52961
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ART1 Rabbit Polyclonal Antibody (orb584605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004305
Preservative
Lyophilized powder
AA Sequence
KHSTYNCEYIKDKKCKSGPCHLDNSAMGQSPLSAVWSLLLLLWFLVVRAF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-M0093-01 24 Tests
Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit
Sign In for Pricing
View Details E-EL-M0093-02 48 Tests
Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit
Sign In for Pricing
View Details E-EL-M0093-03 96 Tests
Mouse ANGPTL4 (Angiopoietin Like Protein 4) ELISA Kit
Sign In for Pricing
View Details 
![CNOT4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B2]](https://cdn.genprice.uk/products/937/68dd1b6d061270361ea1743f/imageurl/ta504474am.webp)
TA504474AM 100 µL
CNOT4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B2]
Sign In for Pricing
View Details 