Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSK-3 beta, Human (sf9, His)

GSK-3β is a serine-threonine kinase and negative regulator of glucose homeostasis. GSK-3β has been implicated in neurodegenerative diseases such as Parkinson's disease and Alzheimer's disease. GSK-3β is widely expressed in multiple tissues, with particularly high levels in the brain and thyroid gland. GSK-3 beta Protein, Human (sf9, His) is the recombinant human-derived GSK-3 beta protein, expressed by Sf9 insect cells , with N-His labeled tag.

Product Specifications

Product Name Alternative

GSK-3 beta Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gsk-3-beta-protein-human-sf9-his.html

Purity

98.40

Smiles

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Molecular Formula

2932 (Gene_ID) P49841-2/NP_002084.2 (M1-T433) (Accession)

Molecular Weight

44-48 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2',3',5'-Tri-O-benzoyl-2'-C-methyluridine
NT07136 5 g

2',3',5'-Tri-O-benzoyl-2'-C-methyluridine

Sign In for Pricing
View Details
Integrin alpha 4 Recombinant Antibody, Biotin Conjugated
bsm-61373R-Biotin-01 20 µL

Integrin alpha 4 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Integrin alpha 4 Recombinant Antibody, Biotin Conjugated
bsm-61373R-Biotin-02 100 µL

Integrin alpha 4 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ACSS2 (ACAS2, Acetyl-coenzyme A Synthetase, Cytoplasmic, Acetate-CoA Ligase, Acetyl-CoA Synthetase, Acyl-CoA Synthetase Short-chain Family Member 2, Acyl-activating Enzyme, DKFZp762G026, DJ1161H23.1) (AP)
MBS6129850-01 0.1 mL

ACSS2 (ACAS2, Acetyl-coenzyme A Synthetase, Cytoplasmic, Acetate-CoA Ligase, Acetyl-CoA Synthetase, Acyl-CoA Synthetase Short-chain Family Member 2, Acyl-activating Enzyme, DKFZp762G026, DJ1161H23.1) (AP)

Sign In for Pricing
View Details
ACSS2 (ACAS2, Acetyl-coenzyme A Synthetase, Cytoplasmic, Acetate-CoA Ligase, Acetyl-CoA Synthetase, Acyl-CoA Synthetase Short-chain Family Member 2, Acyl-activating Enzyme, DKFZp762G026, DJ1161H23.1) (AP)
MBS6129850-02 5x 0.1 mL

ACSS2 (ACAS2, Acetyl-coenzyme A Synthetase, Cytoplasmic, Acetate-CoA Ligase, Acetyl-CoA Synthetase, Acyl-CoA Synthetase Short-chain Family Member 2, Acyl-activating Enzyme, DKFZp762G026, DJ1161H23.1) (AP)

Sign In for Pricing
View Details
Dusp26 Mouse qPCR Template Standard (NM_025869)
MK203751 1 Kit

Dusp26 Mouse qPCR Template Standard (NM_025869)

Sign In for Pricing
View Details