Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asb11 Peptide - N-terminal region

Asb11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1566298

UniProt

D3ZSF1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Asb11 Rabbit Polyclonal Antibody (orb581459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100432

Preservative

Lyophilized powder

AA Sequence

FGDYICHTFQGDCWADRSPLHEAAAQGRLLALKTLIAQGINVNLVTINRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAPK/JNK (Ab-185) Antibody
E021242-2 100 µg -100 µL

SAPK/JNK (Ab-185) Antibody

Sign In for Pricing
View Details
Human Anti-Laminin Subunit Alpha-5 Antibody (Anti-LAMA5) ELISA Kit
abx392456 96 Tests

Human Anti-Laminin Subunit Alpha-5 Antibody (Anti-LAMA5) ELISA Kit

Sign In for Pricing
View Details
KCNA7 Peptide (AAP35365)
AAP35365-100UG 100 µg

KCNA7 Peptide (AAP35365)

Sign In for Pricing
View Details
Trappc9 siRNA Oligos set (Mouse)
47534174 3x 5 nmol

Trappc9 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
ARL5A Conjugated Antibody
orb1616450 100 µL

ARL5A Conjugated Antibody

Sign In for Pricing
View Details
OWL Scientific P8 Comb, 1.5mm thick, 15 tooth
p8-1010-15-1-5 1 Unit

OWL Scientific P8 Comb, 1.5mm thick, 15 tooth

Sign In for Pricing
View Details