ASB3 Peptide - middle region
ASB3 Peptide - middle region
Product Specifications
Product Name Alternative
ASB-3, FLJ10123, FLJ10421, MGC12531, MGC132002, MGC996
UniProt
D6W5B5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ASB3 Rabbit Polyclonal Antibody (orb583689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_665862
Preservative
Lyophilized powder
AA Sequence
LEIRSSLKSERLRSDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
N2375-10D 100 µg
NFATC1 (Nuclear Factor of Activated T-cells, Cytoplasmic 1, NF-ATc1, NFATc1, NFAT Transcription Complex Cytosolic Component, NF-ATc, NFATc, NFAT2, NFATC)
Sign In for Pricing
View Details 
ARP43590_P050-Biotin 100 µL
Cxxc1 Antibody - N-terminal region : Biotin (ARP43590_P050-Biotin)
Sign In for Pricing
View Details 