Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB3 Peptide - middle region

ASB3 Peptide - middle region

Product Specifications

Product Name Alternative

ASB-3, FLJ10123, FLJ10421, MGC12531, MGC132002, MGC996

UniProt

D6W5B5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASB3 Rabbit Polyclonal Antibody (orb583689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665862

Preservative

Lyophilized powder

AA Sequence

LEIRSSLKSERLRSDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ActP Antibody
orb808691 2 mg

ActP Antibody

Sign In for Pricing
View Details
Dnajb6 (NM_001037940) Mouse Tagged ORF Clone Lentiviral Particle
MR219416L3V 200 µL

Dnajb6 (NM_001037940) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SLC2A12 Rabbit Polyclonal Antibody (FITC)
orb2119710 100 µL

SLC2A12 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CAMK2B Antibody (Phospho-Thr287) : FITC (OAAF00436-FITC)
OAAF00436-100UG-FITC 100 µg

CAMK2B Antibody (Phospho-Thr287) : FITC (OAAF00436-FITC)

Sign In for Pricing
View Details
AKR1CL2 Conjugated Antibody
orb1623292 100 µL

AKR1CL2 Conjugated Antibody

Sign In for Pricing
View Details
ERAS Mouse Monoclonal Antibody [D10-B9]
M1505-1 100 µL

ERAS Mouse Monoclonal Antibody [D10-B9]

Sign In for Pricing
View Details