Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB4 Peptide - middle region

ASB4 Peptide - middle region

Product Specifications

Product Name Alternative

ASB-4, MGC142039, MGC142041

UniProt

Q9Y574

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASB4 Rabbit Polyclonal Antibody (orb585204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057200

Preservative

Lyophilized powder

AA Sequence

VAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smim19 (NM_001012667) Mouse Tagged ORF Clone
MG200305 10 µg

Smim19 (NM_001012667) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CELLDATA DNAstormTM 2.0 FFPE DNA Extraction Kit, 50 preps
#CD507 1 Kit

CELLDATA DNAstormTM 2.0 FFPE DNA Extraction Kit, 50 preps

Sign In for Pricing
View Details
Human NAP1L5 activation kit by CRISPRa
GA116952 1 Kit

Human NAP1L5 activation kit by CRISPRa

Sign In for Pricing
View Details
9,10-Dihydro-4H-benzo[4,5]cyclohepta[1,2-b]thiophen-4-one (90%)
TRC-D448480-500MG 500 mg

9,10-Dihydro-4H-benzo[4,5]cyclohepta[1,2-b]thiophen-4-one (90%)

Sign In for Pricing
View Details
Human CCDC86 activation kit by CRISPRa
GA112353 1 Kit

Human CCDC86 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse TIM4/TIMD4 Protein (His Tag)
PKSM040707 100 µg

Recombinant Mouse TIM4/TIMD4 Protein (His Tag)

Sign In for Pricing
View Details