Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB4 Peptide - middle region

ASB4 Peptide - middle region

Product Specifications

Product Name Alternative

ASB-4, MGC142039, MGC142041

UniProt

Q9Y574

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASB4 Rabbit Polyclonal Antibody (orb585204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057200

Preservative

Lyophilized powder

AA Sequence

VAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

11-cis-Retinol, >85%
TRC-R252105-1MG 1 mg

11-cis-Retinol, >85%

Sign In for Pricing
View Details
Tissue FFPE Sections, Tongue
CS708379 5x 5 µm

Tissue FFPE Sections, Tongue

Sign In for Pricing
View Details
hnRNP F (HNRNPF) (NM_001098206) Human Over-expression Lysate
LC420554 20 µg

hnRNP F (HNRNPF) (NM_001098206) Human Over-expression Lysate

Sign In for Pricing
View Details
HRASLS3 (PLA2G16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]
TA506912AM 100 µL

HRASLS3 (PLA2G16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]

Sign In for Pricing
View Details
DEFB126 (NM_030931) Human Over-expression Lysate
LY403096 100 µg

DEFB126 (NM_030931) Human Over-expression Lysate

Sign In for Pricing
View Details
uPA (PLAU) (N-term) Rabbit Polyclonal Antibody
AP15164PU-N 400 µL

uPA (PLAU) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details