Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB7 Peptide - middle region

ASB7 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ22551

UniProt

Q9H672

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASB7 Rabbit Polyclonal Antibody (orb582085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_937886

Preservative

Lyophilized powder

AA Sequence

QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP2B1 Rabbit Monoclonal Antibody [Clone ID: R02-8C5]
TA421670 100 µL

ATP2B1 Rabbit Monoclonal Antibody [Clone ID: R02-8C5]

Sign In for Pricing
View Details
(3S,4S)-Tofacitinib
TRC-T528005-25MG 25 mg

(3S,4S)-Tofacitinib

Sign In for Pricing
View Details
KLF4 (1-170) Mouse Monoclonal Antibody [Clone ID: AT4E6]
AM09057PU-S 50 µL

KLF4 (1-170) Mouse Monoclonal Antibody [Clone ID: AT4E6]

Sign In for Pricing
View Details
Human GPR111 (ADGRF2) activation kit by CRISPRa
GA116675 1 Kit

Human GPR111 (ADGRF2) activation kit by CRISPRa

Sign In for Pricing
View Details
GCP4 (TUBGCP4) Human Gene Knockout Kit (CRISPR)
KN400872 1 Kit

GCP4 (TUBGCP4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF500 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H2]
TA803351BM 100 µL

ZNF500 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H2]

Sign In for Pricing
View Details