Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB7 Peptide - middle region

ASB7 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ22551

UniProt

Q9H672

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASB7 Rabbit Polyclonal Antibody (orb582085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_937886

Preservative

Lyophilized powder

AA Sequence

QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD11a Antibody[TS1/22.1.1.13]
E-AB-F1055D-01 20 Tests

PE Anti-Human CD11a Antibody[TS1/22.1.1.13]

Sign In for Pricing
View Details
PE Anti-Human CD11a Antibody[TS1/22.1.1.13]
E-AB-F1055D-02 100 Tests

PE Anti-Human CD11a Antibody[TS1/22.1.1.13]

Sign In for Pricing
View Details
PE Anti-Human CD11a Antibody[TS1/22.1.1.13]
E-AB-F1055D-03 2x 100 Tests

PE Anti-Human CD11a Antibody[TS1/22.1.1.13]

Sign In for Pricing
View Details
PDE4 (PDE4B) (NM_002600) Human Recombinant Protein
TP311956M 100 µg

PDE4 (PDE4B) (NM_002600) Human Recombinant Protein

Sign In for Pricing
View Details
Beclin 1 (BECN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F3]
TA502527AM 100 µL

Beclin 1 (BECN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS802910 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details