Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASNS Peptide - C-terminal region

ASNS Peptide - C-terminal region

Product Specifications

Product Name Alternative

TS11

UniProt

P08243

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASNS Rabbit Polyclonal Antibody (orb584607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001664

Preservative

Lyophilized powder

AA Sequence

SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TEX13B Antibody [Alexa Fluor 488]
NBP3-06129AF488 0.1 mL

Rabbit Polyclonal TEX13B Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Mouse Serum paraoxonase/arylesterase 2 (PON2) ELISA Kit
MBS2805845-01 48 Tests

Mouse Serum paraoxonase/arylesterase 2 (PON2) ELISA Kit

Sign In for Pricing
View Details
Mouse Serum paraoxonase/arylesterase 2 (PON2) ELISA Kit
MBS2805845-02 96 Tests

Mouse Serum paraoxonase/arylesterase 2 (PON2) ELISA Kit

Sign In for Pricing
View Details
Mouse Serum paraoxonase/arylesterase 2 (PON2) ELISA Kit
MBS2805845-03 5x 96 Tests

Mouse Serum paraoxonase/arylesterase 2 (PON2) ELISA Kit

Sign In for Pricing
View Details
Mouse Serum paraoxonase/arylesterase 2 (PON2) ELISA Kit
MBS2805845-04 10x 96 Tests

Mouse Serum paraoxonase/arylesterase 2 (PON2) ELISA Kit

Sign In for Pricing
View Details
CCKAR Over-expression Lysate Product
GWB-48880F 0.1 mg

CCKAR Over-expression Lysate Product

Sign In for Pricing
View Details