Aste1 Peptide - middle region
Aste1 Peptide - middle region
Product Specifications
Product Name Alternative
1100001A21Rik, AV006403, MGC107393
UniProt
Q8BIR2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Aste1 Rabbit Polyclonal Antibody (orb576462) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079927
Preservative
Lyophilized powder
AA Sequence
YHRVLGLLNWLSHFDDPTEALDNVLKSLPKKSRENVKELLCCSMEEYQQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6210978-01 0.1 mL
CRYBB3 (Beta-crystallin B3, Beta-B3 Crystallin, CRYB3) (MaxLight 550)
Sign In for Pricing
View Details MBS6210978-02 5x 0.1 mL
CRYBB3 (Beta-crystallin B3, Beta-B3 Crystallin, CRYB3) (MaxLight 550)
Sign In for Pricing
View Details GTR15122910 1 Vial
Lentiviral human HHEX shRNA (UAS) - Lentiviral human HHEX shRNA (UAS) (100)
Sign In for Pricing
View Details