Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atf2 Peptide - N-terminal region

Atf2 Peptide - N-terminal region

Product Specifications

UniProt

Q00969

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_112280

Preservative

Lyophilized powder

AA Sequence

TPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SBSN Human Gene Knockout Kit (CRISPR)
KN419831 1 Kit

SBSN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human TAFI protein (His tag)
PDEH100823-01 20 µg

Recombinant Human TAFI protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TAFI protein (His tag)
PDEH100823-02 100 µg

Recombinant Human TAFI protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TAFI protein (His tag)
PDEH100823-03 500 µg

Recombinant Human TAFI protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TAFI protein (His tag)
PDEH100823-04 1 mg

Recombinant Human TAFI protein (His tag)

Sign In for Pricing
View Details
UAP56 (DDX39B) (NM_004640) Human Over-expression Lysate
LC401471 20 µg

UAP56 (DDX39B) (NM_004640) Human Over-expression Lysate

Sign In for Pricing
View Details