Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atf4 Peptide - N-terminal region

Atf4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Atf-4, C/ATF, CREB2, MGC96460, TAXREB67

UniProt

Q5U4B2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_033846

Preservative

Lyophilized powder

AA Sequence

VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPHN2 Rabbit polyclonal Antibody
HA500555 100 µL

LPHN2 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
D-(-)-Diisopropyl Tartrate
TRC-D459700-5G 5 g

D-(-)-Diisopropyl Tartrate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS700952 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
9,10-Dihydro-1-benzo[a]pyrene-7(8H)-one Oxime
TRC-D448425-25MG 25 mg

9,10-Dihydro-1-benzo[a]pyrene-7(8H)-one Oxime

Sign In for Pricing
View Details
NaV1.7 Mouse Monoclonal Antibody [1D6]
EM1701-35 100 µL

NaV1.7 Mouse Monoclonal Antibody [1D6]

Sign In for Pricing
View Details
Mouse Tyrobp activation kit by CRISPRa
GA204507 1 Kit

Mouse Tyrobp activation kit by CRISPRa

Sign In for Pricing
View Details