Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atf4 Peptide - N-terminal region

Atf4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Atf-4, C/ATF, CREB2, MGC96460, TAXREB67

UniProt

Q5U4B2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_033846

Preservative

Lyophilized powder

AA Sequence

VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRFAP1L1 (Center) Rabbit Polyclonal Antibody
AP52745PU-N 400 µL

MRFAP1L1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tide Quencher™ 1 acid [TQ1 acid]
2190-AAT 100 mg

Tide Quencher™ 1 acid [TQ1 acid]

Sign In for Pricing
View Details
Bromotripyrrolidinophosphonium Hexafluorophosphate
TRC-B687965-5G 5 g

Bromotripyrrolidinophosphonium Hexafluorophosphate

Sign In for Pricing
View Details
Phospho-EGFR Antibody (pY998)
F48503-0.4ML 0.4 mL

Phospho-EGFR Antibody (pY998)

Sign In for Pricing
View Details
STEAP2 Human Gene Knockout Kit (CRISPR)
KN215845LP 1 Kit

STEAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human BCMO1 (BCO1) activation kit by CRISPRa
GA110018 1 Kit

Human BCMO1 (BCO1) activation kit by CRISPRa

Sign In for Pricing
View Details