Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atf6 Peptide - C-terminal region

Atf6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9130025P16Rik, 9630036G24, AA789574, Atf6alpha, ESTM49

UniProt

B2RU98

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001074773

Preservative

Lyophilized powder

AA Sequence

QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trimeprazine Sulfoxide
TRC-T795603-250MG 250 mg

Trimeprazine Sulfoxide

Sign In for Pricing
View Details
ARHGAP11B (NM_001039841) Human Over-expression Lysate
LC421835 20 µg

ARHGAP11B (NM_001039841) Human Over-expression Lysate

Sign In for Pricing
View Details
HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF488A conjugate, 0.1mg/mL
BNC883073-100 1x 100 µL

HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF647 conjugate, 0.1mg/mL
BNC472386-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HOOK3 (NM_032410) Human Recombinant Protein
TP308912 20 µg

HOOK3 (NM_032410) Human Recombinant Protein

Sign In for Pricing
View Details
MMP2 Polyclonal Antibody
E-AB-61181-01 60 µL

MMP2 Polyclonal Antibody

Sign In for Pricing
View Details