Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atg12 Peptide - C-terminal region

Atg12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Apg12l, MGC125080

UniProt

Q2TBJ5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atg12 Rabbit Polyclonal Antibody (orb584201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001033584

Preservative

Lyophilized powder

AA Sequence

TRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP3 Antibody
KC-3606-01 50 μL

SP3 Antibody

Sign In for Pricing
View Details
SP3 Antibody
KC-3606-02 100 µL

SP3 Antibody

Sign In for Pricing
View Details
SP3 Antibody
KC-3606-03 1 mL

SP3 Antibody

Sign In for Pricing
View Details
FH Antibody
KC-2215-01 50 μL

FH Antibody

Sign In for Pricing
View Details
FH Antibody
KC-2215-02 100 µL

FH Antibody

Sign In for Pricing
View Details
FH Antibody
KC-2215-03 1 mL

FH Antibody

Sign In for Pricing
View Details