Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atg12 Peptide - C-terminal region

Atg12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Apg12l, MGC125080

UniProt

Q2TBJ5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Atg12 Rabbit Polyclonal Antibody (orb584201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001033584

Preservative

Lyophilized powder

AA Sequence

TRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS714350 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Irak3 Mouse Gene Knockout Kit (CRISPR)
KN308417RB 1 Kit

Irak3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAD51 Antibody
KC-1368-01 50 μL

RAD51 Antibody

Sign In for Pricing
View Details
RAD51 Antibody
KC-1368-02 100 µL

RAD51 Antibody

Sign In for Pricing
View Details
RAD51 Antibody
KC-1368-03 1 mL

RAD51 Antibody

Sign In for Pricing
View Details
Recombinant Human NUDT5/ADP-sugar Pyrophosphatase Protein (His Tag)
PKSH030745 50 µg

Recombinant Human NUDT5/ADP-sugar Pyrophosphatase Protein (His Tag)

Sign In for Pricing
View Details