Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG2A Peptide - N-terminal region

ATG2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA0404, MGC117153

UniProt

Q2TAZ0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG2A Rabbit Polyclonal Antibody (orb582654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055919

Preservative

Lyophilized powder

AA Sequence

PRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDT1 Antibody
45231-01 50 µL

CDT1 Antibody

Sign In for Pricing
View Details
CDT1 Antibody
45231-02 100 µL

CDT1 Antibody

Sign In for Pricing
View Details
Recombinant Human Inactive carboxypeptidase-like protein X2 (CPXM2)
MBS1328185-01 0.02 mg (E-Coli)

Recombinant Human Inactive carboxypeptidase-like protein X2 (CPXM2)

Sign In for Pricing
View Details
Recombinant Human Inactive carboxypeptidase-like protein X2 (CPXM2)
MBS1328185-02 0.02 mg (Yeast)

Recombinant Human Inactive carboxypeptidase-like protein X2 (CPXM2)

Sign In for Pricing
View Details
Recombinant Human Inactive carboxypeptidase-like protein X2 (CPXM2)
MBS1328185-03 0.1 mg (Yeast)

Recombinant Human Inactive carboxypeptidase-like protein X2 (CPXM2)

Sign In for Pricing
View Details
Recombinant Human Inactive carboxypeptidase-like protein X2 (CPXM2)
MBS1328185-04 0.1 mg (E-Coli)

Recombinant Human Inactive carboxypeptidase-like protein X2 (CPXM2)

Sign In for Pricing
View Details