Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG2A Peptide - N-terminal region

ATG2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA0404, MGC117153

UniProt

Q2TAZ0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG2A Rabbit Polyclonal Antibody (orb582654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055919

Preservative

Lyophilized powder

AA Sequence

PRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Zea mays (Maize) GST1 Polyclonal Antibody
MBS7152189 Inquire

Rabbit anti-Zea mays (Maize) GST1 Polyclonal Antibody

Sign In for Pricing
View Details
pEGFP-FAK Plasmid
PVT7212 2 µg

pEGFP-FAK Plasmid

Sign In for Pricing
View Details
COX4I1 ELISA Kit (Bovine) (OKEH07535)
OKEH07535 96 Well

COX4I1 ELISA Kit (Bovine) (OKEH07535)

Sign In for Pricing
View Details
Anti-CIC Antibody
MBS1751239-01 0.01 mg

Anti-CIC Antibody

Sign In for Pricing
View Details
Anti-CIC Antibody
MBS1751239-02 0.1 mg (Carrier Free)

Anti-CIC Antibody

Sign In for Pricing
View Details
Anti-CIC Antibody
MBS1751239-03 0.1 mg

Anti-CIC Antibody

Sign In for Pricing
View Details