Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG3 Peptide - middle region

ATG3 Peptide - middle region

Product Specifications

Product Name Alternative

APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96

UniProt

Q9NT62

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG3 Rabbit Polyclonal Antibody (orb582262) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071933

Preservative

Lyophilized powder

AA Sequence

LWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBX9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0371408 1.0 µg DNA

CBX9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PLC β3 Polyclonal Antibody
41352-01 50 µL

PLC β3 Polyclonal Antibody

Sign In for Pricing
View Details
PLC β3 Polyclonal Antibody
41352-02 100 µL

PLC β3 Polyclonal Antibody

Sign In for Pricing
View Details
CNTFR Antibody
orb1561787-01 50 µL

CNTFR Antibody

Sign In for Pricing
View Details
CNTFR Antibody
orb1561787-02 100 µL

CNTFR Antibody

Sign In for Pricing
View Details
CNTFR Antibody
orb1561787-03 200 µL

CNTFR Antibody

Sign In for Pricing
View Details