ATG3 Peptide - middle region
ATG3 Peptide - middle region
Product Specifications
Product Name Alternative
APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96
UniProt
Q9NT62
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATG3 Rabbit Polyclonal Antibody (orb584212) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071933
Preservative
Lyophilized powder
AA Sequence
SDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
035125-ML490 100 µL
EphB3 (EPHB3, ETK2, HEK2, TYRO6, Ephrin type-B receptor 3, EPH-like tyrosine kinase 2, Embryonic kinase 2, Tyrosine-protein kinase TYRO6) (MaxLight 490) discontinued
Sign In for Pricing
View Details MBS6012694-02 5x 0.2 mL
ZNF662, CT (ZNF662, Zinc finger protein 662)
Sign In for Pricing
View Details