Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG4A Peptide - middle region

ATG4A Peptide - middle region

Product Specifications

Product Name Alternative

APG4A, AUTL2

UniProt

Q8WYN0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG4A Rabbit Polyclonal Antibody (orb578584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443168

Preservative

Lyophilized powder

AA Sequence

PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPIB, CT (SPIB, Transcription factor Spi-B) (MaxLight 490) discontinued
042230-ML490 100 µL

SPIB, CT (SPIB, Transcription factor Spi-B) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ANR52 (ANKRD52) (NM_173595) Human Over-expression Lysate
LS283373 100 µg

ANR52 (ANKRD52) (NM_173595) Human Over-expression Lysate

Sign In for Pricing
View Details
ANKS1B Rabbit pAb
orb2714113-01 50 µL

ANKS1B Rabbit pAb

Sign In for Pricing
View Details
ANKS1B Rabbit pAb
orb2714113-02 100 µL

ANKS1B Rabbit pAb

Sign In for Pricing
View Details
Slc6a20b Protein Vector (Mouse) (pPB-C-His)
PV231262 500 ng

Slc6a20b Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Hoxb1, NT (Hoxb1, Hox-2.9, Hoxb-1, Homeobox protein Hox-B1, Homeobox protein Hox-2.9) (MaxLight 490) discontinued
036696-ML490 100 µL

Hoxb1, NT (Hoxb1, Hox-2.9, Hoxb-1, Homeobox protein Hox-B1, Homeobox protein Hox-2.9) (MaxLight 490) discontinued

Sign In for Pricing
View Details