Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG4C Peptide - middle region

ATG4C Peptide - middle region

Product Specifications

Product Name Alternative

APG4-C, APG4C, AUTL1, AUTL3, FLJ14867

UniProt

Q96DT6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG4C Rabbit Polyclonal Antibody (orb584139) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835739

Preservative

Lyophilized powder

AA Sequence

TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFalpha (MF9), CF594 conjugate, 0.1mg/mL
BNC940644-100 1x 100 µL

TGFalpha (MF9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100a4 Mouse Gene Knockout Kit (CRISPR)
KN315238BN 1 Kit

S100a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CD85d Recombinant Rabbit Monoclonal Antibody [PSH05-61] - BSA and Azide free (Capture)
HA722381 100 µL

Human CD85d Recombinant Rabbit Monoclonal Antibody [PSH05-61] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
ZNF76 Antibody
8C10573-AAT 50 µg

ZNF76 Antibody

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF647 conjugate, 0.1mg/mL
BNC470795-100 1x 100 µL

CD56 / NCAM (NCAM1/795), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D2 (CCND2/2620), CF488A conjugate, 0.1mg/mL
BNC882620-500 1x 500 µL

Cyclin D2 (CCND2/2620), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details