Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG4C Peptide - middle region

ATG4C Peptide - middle region

Product Specifications

Product Name Alternative

APG4-C, APG4C, AUTL1, AUTL3, FLJ14867

UniProt

Q96DT6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG4C Rabbit Polyclonal Antibody (orb584139) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835739

Preservative

Lyophilized powder

AA Sequence

TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Mouse Monoclonal Antibody [Clone ID: OTI3A7]
CF813211 100 µg

CD40 Mouse Monoclonal Antibody [Clone ID: OTI3A7]

Sign In for Pricing
View Details
Ap4s1 Mouse Gene Knockout Kit (CRISPR)
KN501374 1 Kit

Ap4s1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAU2 (NM_001164380) Human Over-expression Lysate
LC431491 20 µg

STAU2 (NM_001164380) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR560485 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®568 Conjugate - Biotium Choice
P038-568-1ML 1x 1 mL

DNP Recombinant Monoclonal Rat Antibody (rLO-DNP-2), CF®568 Conjugate - Biotium Choice

Sign In for Pricing
View Details
H3FT (HIST3H3) Rabbit Monoclonal Antibody [Clone ID: R06-4I8]
TA384388 100 µL

H3FT (HIST3H3) Rabbit Monoclonal Antibody [Clone ID: R06-4I8]

Sign In for Pricing
View Details