Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG4D Peptide - middle region

ATG4D Peptide - middle region

Product Specifications

Product Name Alternative

APG4-D, APG4D, AUTL4

UniProt

Q86TL0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG4D Rabbit Polyclonal Antibody (orb331005) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116274

Preservative

Lyophilized powder

AA Sequence

AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF17 Conjugated Antibody
MBS9453498-01 0.1 mL (AF350)

ARHGEF17 Conjugated Antibody

Sign In for Pricing
View Details
ARHGEF17 Conjugated Antibody
MBS9453498-02 0.1 mL (AF405)

ARHGEF17 Conjugated Antibody

Sign In for Pricing
View Details
ARHGEF17 Conjugated Antibody
MBS9453498-03 0.1 mL (AF488)

ARHGEF17 Conjugated Antibody

Sign In for Pricing
View Details
ARHGEF17 Conjugated Antibody
MBS9453498-04 0.1 mL (AF555)

ARHGEF17 Conjugated Antibody

Sign In for Pricing
View Details
ARHGEF17 Conjugated Antibody
MBS9453498-05 0.1 mL (Biotin)

ARHGEF17 Conjugated Antibody

Sign In for Pricing
View Details
SNRPB2 Antibody (N-term) Blocking peptide
MBS9219079-01 0.5 mg

SNRPB2 Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details